BDSM

Taking Control Part 1

When desire meets submission...

Spankmasters
Aug 3, 2024
22 min read
controlanalsubmissiveslavefingeringwhippingsuspensionTaking Control Part 1bondagedomination
Taking Control Part 1
Taking Control Part 1

Taking Control Part 1

Return

Ava stood gazing out of the tall broad window, surveying the bustling city. She had to admit the view from the vantage point thirty floors up was magnificent. She walked up closer towards the smoked glass, peering at the small figures moving around the busy streets below. Her heart skipped a beat, feeling the vertigo she'd experienced as a child, heady times when her father had taken her climbing in the steep foothills of the French Pyrenees, near Biarritz.

Up here in the large office atrium the atmosphere was an oasis of silent calm, utterly isolated from the noise and magnetic energy of the daily work going on at street level. She looked at her watch thinking how amazing it was that, in just one hour, the scene would change completely, as workers wended their long way back home.

Ava strolled over to the large desk stationed along the edge of one sleek wall, running a long finger experimentally over its surface. Barely the minutest ridge betraying the dark grain of the exotic hardwood, its polished surface naked apart from an exquisite oriental orchid. Subtle uplighting inset along the top of smooth cream walls cast a subtle glow along large rectangular panels, with expensive green art deco silk fabric set in wide mahogany frames.

She had arrived in the large, fast lift a few minutes earlier. Ava checked her appearance in the gilt coloured mirror surface doors. Not bad. The dark Katherine Hamnett outfit was tight, suiting her slim, graceful figure. She was neither an egotist nor self-conscious, but was well aware how others viewed the lustrous sheen of her long chestnut hair, her attractive tanned skin and wide green eyes.

Looks had their advantages in life, but that was the start and end of it for her. She preferred to use her feminine intuition and brains. Drive and ambition was really all that mattered in the finance world.

She paused to consider the strange sequence of events that had brought her here. The brief email that had arrived in her inbox, barely a week ago, out of the blue. She was shocked when she'd glanced at the name at the top, recognising it instantly. Knowing it definitely had to be him, even after all these years. As she read the brief message inviting her to his office, she felt a strange fluttering sensation, something she hadn't experienced in a long time.

In the many intervening years since they'd last seen each other she'd kept a low profile, closed social media accounts, even changed her name. She'd become virtually untraceable, invisible except to those in the know, or in the inner circles of her small finance world.

So how exactly could he have tracked her down? And why would he contact her now, after all this time? Why, after all the things that she'd been through, and the things they'd both done to each other?

She remembered how they'd first met, a decade ago now. Strong memories stirred inside her, creating goose bumps down her spine. The reasons they'd parted were multiple, and she'd felt mutual. But the intense times they'd spent together had been more than just a youthful phase, they'd been mentally demanding and physically challenging, as well as downright exhilarating and fundamentally life changing too. Or at least she felt for her. Maybe for him too then?

How much did he really remember of her needs and what they'd done with each other? And how did he feel about her now, and the shocking event that had forced them both apart all those years ago?

Ava knew that was the real reason she was here, she just had to know once and for all. To see if Lorenzo had matured in his views from those of that headstrong young man, but also to see if he still desired the same thing she did, that need so strong and primal that anyone who spent time in a professional world kept it well hidden.

New beginnings

On the very first day they'd noticed each other in the lecture hall, both of them studying banking and finance at the college. He was dark, suave and confident, she was beautiful, sexy, edgy, nervous.

The first view Lorenzo had of Ava was by the small refreshment stand next to the lecture theatre. What caught his attention was the suggestive way that she drank her coffee, tipping the cup gently towards her mouth, caressing the edge of the cup with her lips as she sipped at the hot, foamy liquid. He suspected he'd be happy watching her doing this all day, but their first lecture beckoned.

They'd both glanced at each other again across the wide room, as they sought places to sit in the banked rows of seats. He watched her from a position back and to the right of where she'd decided to sit, near the front of the class to be more attentive to their lecturer.

That first day he was content just to watch her. She moved with a slow, sensual walk in-between their many lectures, taking in all the world around her in an interested and animated manner. A way at odds with most of the other students, who mostly studied their phone screens for messages, or spent time flirting with each other.

Towards the end of the day he'd headed to the library, to see if he could borrow some of their finance course text books. To his surprise there she was, standing in a corner, by the photocopier.

That was when he first glimpsed her naked skin. She was bending over the tall industrial copier machine, opening a book at a specific page, placing it on the large glass copier plate. He saw her T-shirt ride up and it then he saw it, a light tattoo in the middle of her deeply tanned back. A small oriental marking, briefly exposed as she leant out over the copier.

He had little time to make out what it was, the tattoo only just showing above dark silky panties, peeping out provocatively above the line of her tight black hipster trousers.

He watched her for the next few minutes as she moved and swivelled over the copier, a motion showing off her firm, sexy bum to perfection. All he knew was that he desperately wanted this girl.

But first he had to find out more about her, who she was. Some casual research, and polite chats with other students he'd already met, revealed that her name was Ava. She was studying the same intense three year finance course he was, and it turned out that they shared almost all of their classes during the first semester.

That first week of term he spent hours in the back of lectures, gazing at the gleaming shine from her glossy hair, tucked up in a tight dark coil above the delicious curve of her neck. Then, mid-week, he suddenly spotted her turning round, briefly looking at him. He wondered, had she deliberately try to catch his eye?

Like most young women, Ava was attuned to catching glances from admiring men, but was not yet experienced enough to know what to do next to capture their attention, or how to handle them. The reality was Ava liked the look of Lorenzo, but he appeared so amazingly confident, almost completely unapproachable. Quite the opposite of how she felt about herself. She was simply too shy to try and introduce herself, or to try and strike up a conversation.

When two people have a natural thing for each other, events always have a habit of coming to a head. Over the following days, things hotted up between the pair of them. On several occasions Lorenzo saw Ava pretending to look in her bag, or bend down to get something from under her seat, taking a furtive glance behind her. Then, on the fifth day of lectures, she glanced directly at him for a brief moment, holding eye contact for a few microseconds, before turning away again quickly. He could have sworn her neck blushed.

That was all the encouragement he needed, and he knew the game was on. He'd always imagined he was going to have fun when he'd arrived at University, but never imagined that circumstances could become quite so interesting and delicious, and so quickly too.

The challenge he had was that she always hurried off to her next class, rather than hanging around between lectures to chat, like the other students. After a few more frustrating days of trying to track her, like a jinking hare, he decided he had to make the first move.

At the end of one of their Friday lecture he raced for the door at the front, pulling out a flyer for the amateur dramatics theatre group he'd seen lying in a pile on the desk in the student office. He stopped her, just as she tried to squeeze past him, putting his arm around her to take her aside in a gentle, yet commanding manner.

In truth she was relieved that he had broken the ice as, try as she might, she simply hadn't been able to pluck up the courage to speak to him, or work out something quirky to say. She knew his name too by now, practising saying it out loud to herself, Lorenzo. She thought he was gorgeous, a statuesque example of young, virile masculinity.

In his deep, engaging voice, he started talking about acting. How she'd be perfect for a student production that he was organising. Then, within a minute, he'd asked her out for a drink that evening. He said it was to discuss the student play, a part he had in mind for her, and she'd readily agreed to meet him at a local cosy city bar.

It was only when they were both sitting at a table talking together, that evening, that he admitted the theatre flyer had all been a ruse just to get to meet her. She'd laughed at that. When they mutually sensed the ice was broken between them, they'd got roaring drunk that first night together, challenging each other with rounds of tequila shots. He'd walked her back from the bar to her college dorm, him steady, her staggering slightly. He paused at the entrance door to take her hand, kiss it gently, then release it. He'd skipped off with a casual wave, disappearing rapidly into the dark.

The next day Ava woke with a raging headache and a vow never to touch agave spirit ever again, or at least not until next weekend. Despite the relaxed feeling she'd had talking and being with Lorenzo the previous evening, she was still nervous about them meeting up again at lectures the next week, and she'd deliberately not given him her contact number at the end of the evening.

When they'd sat together in the bar the previous night, Lorenzo had been an unusually good listener, as well as having a charming and easy-going manner. After a few tequila shots, a drink she just wasn't used to, she'd started telling him things she rarely divulged to anyone, apart from her very close female friends. And that was the problem. Now she was beginning to get worried she'd given too much away about herself.

She decided to keep her mobile phone switched off until Monday. She realised she really liked Lorenzo a lot, and that meant wanting to keep her allure fresh and exciting, for as long as possible. After all, every woman knew maintaining your mystery was a key part of the early game. Any man could easily lose interest unless they were kept intrigued and engaged, for as long as possible. Or at least until they'd decided they were really interested in you.

Lorenzo was a real enigma compared to the few men she'd met and dated. He was clearly highly confident, headstrong and not just a little impulsive, all elements that made him instantly attractive to her. But there was also a strange, darker side to him she'd picked up on early in the evening, something she couldn't quite put her finger on. She still didn't know what it meant. It was partly the way he looked at her so calmly and yet intently, keeping her gaze that little bit too long for it to be completely comfortable. Maybe it was just that he was really into her, just like she felt she might be with him.

But no, that wasn't quite it. There was something much more to it than that. With a sigh she sank into the chair, thinking, realising it would drive her mad all weekend until she got to the bottom of it.

On Monday, back at college, she deliberately stationed herself at the coffee bar outside the lecture hall, knowing he was bound to see her as he came in through the big double doors. When she spotted his red scarf outside the entrance she'd had just enough time to compose herself, turning back on her stool to the bar. She watched his reflection in a long glass window as she saw him pause, stop, and then start to walk over. She pretended to be unaware of him as he joined her, resting his arms on the white counter beside her.

"Hi Ava. You had a good weekend? That was a fantastic night out at the bar on Friday. Hope you enjoyed it as much as I did? Sorry I dragged you there under false pretences. No acting part available."

His tone seemed casual at first, but then he was rambling. Ava knew from the way he'd stopped before he'd come over that he was as nervous and guarded as she was, and that he'd also asked two questions in quick succession. She had to play it cool. Too much of both of their feelings were at stake to jump into things quickly now.

"Which question did you want me to answer first, Lorenzo?"

"Eh? Oh, sorry. I guess I was gabbling there. But a good night?"

"I had a cool time. Thanks. Did we really knock back eight of those tequila slammers? I had a head like a bear the next day."

She kept it light, giving him wriggle room just in case he had only really been after a good night out after all. That way they could both blame it on the alcohol. Neither of them had yet mentioned the kiss.

"Sure I got up pretty late. But I do remember all of the night, in case you're wondering. Perhaps we can do it again some time, but maybe this time with a little less tequila. That's if you're up for it?"

So it was out there. He liked her, and he was keen to see more of her too. Ava knew it was up to her. Lorenzo was putting her in the driving seat as to where this went next. But then they still had to decide between them exactly what 'this' was. She watched him order a large coffee, take a sip, studying the way he moved his mouth gently to suck a sliver of foam from the cappuccino off his upper lip. Not knowing that she was now doing exactly the same thing he had, when watching Ava at the coffee bar that first day.

In her mind, she was already imagining just what it would be like to kiss him. He glanced over at her, mid thought, and they both blushed simultaneously. It was one of those moments when nothing needed saying. They sat at the bar, drinking their coffees in silence.

When the bell rang for lectures, neither of them wanted to be the first to move. In the end it was Lorenzo who grabbed his scarf and leather satchel, bulging with study books. It seemed a completely natural, casual action when he put out his hand to help her hop off her cafeĢ bar stool. Yep, he was definitely interested.

The library

What happened next in their relationship was when Ava knew things weren't that simple. For the two of them there was never going to be a regular boy meets girl scenario, with boy waiting until girl decides precisely when to let boy get physical. Despite his calm demeanour and gentlemanly behaviour, Lorenzo had other ideas.

It was a Wednesday afternoon. Ava had been thinking about doing some library research on their latest college assignment. She knew it would be hot in the library, it always was, so she had on a light top and knee length skirt. That way she could stay comfortable. Most of Lorenzo's friends had gone off to play sports at the various grounds and arenas around the college. So she was surprised, but also secretly pleased, when he suggested he join her in the library.

The brainchild of a radical eighties architect, the college library was a huge white building that looked like it had been built inside out. The exterior looked a bit dated, almost like it had been built from Lego bricks. But, inside the architect's vision had stood the test of time, creating a large, open, calm space for students to study and read in. Its most unusual feature was its large, wide bay windows that overlooked the main sports fields. Huge single panes of double-glazed smoked glass, with counters at elbow height, a metre deep. It was no surprise students often came to the top floor to study, knowing they could take a well-earned break to watch their favourite sports in action, from this fantastic vantage point.

That day it was quiet, with three of the top sports teams in action, and many of the students having abandoned study in favour of watching their favourite teams and potential new crushes from the field terraces. It was a chance to get close to your team, grab a few beers and have a shout along with friends, as part of the deal.

When Ava and Lorenzo reached the top floor, there was only one other student to be seen. They'd barely had time to pick a table in a corner of the library, an area with muted lighting away from the big rectangular windows, when the girl exclaimed something loudly. She jumped up from her seat and began bundling everything into a big orange bag. A minute later she had disappeared hurriedly through a side exit. Clearly she had somewhere to be, and was now very late.

They settled in at the long table, spreading out all their college books and notepads. Ava checked her reading list for the tricky essay they both had to do. She was missing one textbook. As she got up from the table she smiled at Lorenzo, sitting across from her.

"Back in a second. There's a book I need. Don't go away now."

"As if. I'd much rather be out there on the sports field, but these essays don't seem to write themselves, as I'm quickly finding out."

She headed down a nearby line of books, subtly glowing from uplighting along deep shelves, everything in the building carefully designed to relieve eye strain. Lorenzo watched her go thoughtfully. He got up, pulled dozens of books out, piling them up on their table.

Beside one of the long wide windows, in the end aisle, she found the volume she was looking for. As she leafed through, to check what she was after, her attention was caught by a small movement outside. She turned to watch a player in red shirt and white shorts heading at high speed for goal, a solitary defender left struggling to keep up with him. Surely he would score? Intrigued as much as anything by his athletic grace, she walked the few steps over to the long stretch of smoky glass, facing the field. Placing the book to one side she rested her elbows on the metre wide oak wood windowsill, leaning forward to watch, standing on tiptoes to see this wonderful specimen of manhood a little better, out of the long wide window.

She watched him kick the ball expertly off his left foot, and score. Ava made a fist but, suddenly aware of being in the library, turned what was going to be a loud exclamation into a hissed, "Yes!"

She was entirely unprepared for what happened next. As she began to lean backwards, coming down off her toes, she felt a strong hand push her forcefully forwards. Her elbows slipped on the counter, and she had to put out her arms in front of her to recover her balance. Behind the hand pushed her even further forward. She began to panic. What was happening? Before she could cry out she heard a familiar voice behind her, hot breath whispering in her ear.

"Ava, it's me, Lorenzo. Sorry if I startled you. It's just I saw you there leaning in at the window. Something just came over me. It's that tight grey skirt you've got on. Look, I didn't mean to scare you."

She stood there, stock still. What the hell had just happened to him? They'd barely touched before now, even in the car, drinking tequila. Yet Lorenzo had appeared out of nowhere and was now standing behind her. Was he trying to force himself on her? She said nothing for a minute, taking in the pressure of his hand between her shoulder blades, her breasts pushed firmly forward, against the sill.

She let her body slowly begin to counteract the rapid onset of the boost of adrenaline his sudden action had pumped into her system. New chemicals were now beginning to steady her racing heart and ragged breathing. She was relieved, yet strangely excited. But this wouldn't do. She had to make it clear who was in control.

"What exactly are you playing at Lorenzo? I like you, but this is all a bit unexpected. How do you know we're even alone in here?"

She had deliberately used his name, like his mother might have done when he was younger, making him recognise and take responsibility for what was now happening, or about to happen.

"It's just us, I checked first. Look, I have to tell you something."

Ava tensed but felt his hand pressure on her back relax slightly.

"Well make it quick and good, my back's beginning to hurt."

"Ava, I really want you. I've wanted you since I first saw you."

"Not very politically correct. Remember 'me too'? It's women who decide what goes these days. So what are you doing Lorenzo?"

"You hopefully. Sorry, shit! That was bad and incredibly crude."

Ava was taken aback. Barely a week of knowing this guy and here he was, in a library corner, swearing in front of her for the first time and apparently considering having his way with her. But, regardless of her immediate anger toward him, something inside her desperately wanted to see how this tense situation was going to play out. Despite the shock of it at first, she was also getting really turned on. Time to take a gamble. Maybe a really big gamble.

"So what happens next? I can hardly move. You know that."

"Trust me Ava. I think you'll understand, when this happens."

Lorenzo moved in close behind her. She felt his body press hard against hers, then a jolt of electricity ran down her spine as he leant in, kissing behind her right ear, nibbling her neck lightly just below the tied bun of her long chestnut hair.

"Shit Lorenzo. Phew! That's taking things onto another level."

"Do you think you trust me Ava? I mean really trust me?"

"Come on, I hardly know you. What do you need my trust for?"

"This."

He leant forward, pushing both her hands towards the safety bar that ran at a height of six inches all along the length of the window.

"Grab that bar in front of you. Use both of your hands."

She had to lean far forward to grasp the stainless steel bar, her calves straining as she stood high up on her toes, slim waist pushed into the edge of the broad expanse of oak. Ava's arms and shoulders were taut, her round breasts hanging gently just above the sill. Her legs began to quiver with tension, then went weak as he kissed her again, nuzzling his tongue amongst the dark stray hairs that fell around her neck. She began to breathe hard again, suddenly feeling a warm sticky moisture begin in her panties, between her legs.

"Now, don't let go of that bar, Ava. Whatever you do."

"Why, what would happen then?"

"You don't want to know, believe me."

That last remark had sounded colder. Ava felt a bit anxious. She swallowed hard, but didn't let go of the steel bar. She had to know what this all meant. Had to know why she felt so scared yet excited, more alive at this very moment, than she had felt in a long time.

She felt him lift her blouse out of her skirt, at her waist. He ran a cool hand up her back, onto her bra strap. She'd put on a black lace brassiere that looked good rather than supporting her properly. She closed her eyes and tensed her stomach as smooth hands slid round her waist, pulling her blouse free. He slowly raised her blouse at the back until her bra strap was exposed, expertly flipping the metal clasp open. Ava felt a tightness under her arms from her breasts, as their soft weight suddenly swung out free from underneath her. She opened her eyes again, her breathing quickening. Her head bent forward, each time she took a sharp intake of breath she watched her nipples move up and down, lightly touching the surface of the wooden sill with each excited exhalation. Every contact was like a tiny spark and her nipples began to swell, on fire with expectation.

"Breath out now Ava."

She was confused, but did as she was beckoned. His hands swiftly rotated her skirt anticlockwise. What was he doing? She felt his hand move around her right buttock to the front of her thigh. Leaving the skirt waist clip in place, there was a zing as he pulled down the long zip that ran half the depth of the fabric. Seconds later his hand entered the newly created gap in the zip in her tight skirt, slowly snaking its way towards the top of her black lace panties.

Ava gulped. If she wanted out, she realised now was the time to say something. But she knew her subconscious was in charge, so she stayed still. Her thighs were tense and beginning to shake, her hands slipping, struggling to grip the shiny window bar in front of her.

It was still a shock when she felt his hand curve over the top of her flimsy lace panties, and begin to make its way steadily down. His hot digit parted her short soft pubic curls. She had a sudden wish that she'd shaved, then chided herself, realising how ridiculous that train of thought was. How the hell could she have known that this afternoon she was going to let herself be dominated in a library?

Seconds later his index finger delved into the crease between her soft labia, dipping inside her. Using the juices of her own excitement to help him in his task, he slid it back upwards, the tip of his finger touching the hard nub of her clitoris. Ava jumped, fighting to keep a grip on the window bar. He began to rub and rotate his digit around the delicate organ. Lorenzo was clearly no amateur at this.

Ava bit her lip, struggling to retain control of her body and where these sensations were quickly taking her, everything happening so fast. Lorenzo's left hand began to move smoothly over her buttocks, tense underneath her tight skirt. His hand moved round her waist, under her blouse and over her flat stomach. Reaching forward he grasped the weight of her left breast firmly, hefting it in his hand, testing her. He slid his fingers around her soft globe, pausing to grip her hard, extended nipples between his middle fingers. He began to squeeze his fingers together over her nipple to the same rhythm as he was rubbing her clitoris, turning her on with her own little throbbing sex button. Ava moaned. Her love-purse oozed.

Lorenzo's right hand slid back down her glistening pussy crease, his middle finger slipping all the way in readily, deep within her. Ava squeezed the hand now inside her. She was about to lose all control.

"I think you're about ready. Now it's my turn Ava."

Behind her she heard the clink of a belt being undone, then the sound of a zip. There was a rustling fabric sound followed by the unmistakeable quiet snap of something being pulled free of elastic.

She realised with a start that despite what her emotions wanted at that moment, she simply couldn't allow this to happen.

"Lorenzo no, you have to stop now! I'm not on the pill."

There was a silence and pause behind her. All she could hear was her own laboured, excited breathing. She was so turned on. It couldn't finish like this, could it? She looked in the reflection of the glass. There was no-one there. Ava made an important decision.

"Look, I'm going to turn around. It's my turn to be in control."

She released the window bar, almost staggering as she came down off her tip-toes. She twisted slowly, confronted by a fabulous stiff specimen of manhood. Lorenzo was already fully erect and ready for her. This was going to be much easier than she thought.

"Move in, towards me. I'll lean back against the wall"

Lorenzo looked frustrated, but did as he was bid, his dark chinos around his ankles hampering his progress, as he shuffled forward.

"Stand still and put your hands either side, on the window sill."

As Lorenzo leaned forward Ava slowly and provocatively moved her tight skirt up around her waist. Slipping her long fingers in sides of her black panties she watched as the expression on Lorenzo's face change. Keeping his gaze she slid her panties down slowly just a few inches over her taut thighs. She watched him as he looked down at her lightly furred mound, its curls already damp with juices.

"Yes, Lorenzo. That's what you're about to get. On my terms."

She grabbed his long penis forcefully, then slowly began to move her slender hand back and forth around his strong, hot member. His hands were spread either side of her, his arms occasionally brushing the sides of her breasts as she moved, Ava saw he was studying her hand and its steady rhythmic action on his penis. She desperately needed her own satisfaction, deciding to take things up a notch.

She leant forward, placing the sizzling tip of his member at the entrance to her glistening tunnel. Lorenzo gasped but held steady. Ava began to gently rub his manhood over her clitoris, pausing to slip the head of his cock down into the edge of her vagina, coating it with her essence. She moved it back up again, using him to get her pleasure, to rub her clitoris until she could hardly contain herself any longer. She slipped his penis tip back between her labia once more, relishing the fullness of his throbbing cock between her legs. She had to time this just right. Ava pushed back slightly, pulling him out of her as she started to pump him faster, more forcefully. Her other hand slipped between her legs to rub furiously at her clitoris.

When she was about to come she increased the pace of her hand on his cock, concentrating her efforts on its hot head. Almost as she felt the first wave of her orgasm hit, Lorenzo's whole body tensed. She slowed her fast pace, steadily squeezing the end of his cock with her hand. Extracting a slim finger from her throbbing nub she pulled the front of her panties forward, ready for what she knew was just moments away. Lorenzo groaned quietly as he came, a warm milky jet of semen shooting forward to hit her flat stomach and dribble down into the small waiting lace hammock of her black panties.

A few seconds later, her fingers back rubbing her clitoris, Ava's legs began to quake. She had to lean back harder to steady herself against the wall as she came too, a glorious wave washing over her from her core all the way up to her swelling breasts. She watched the wild expression in his eyes with a smile, slowly pulling her damp panties back up, his warm white jism smearing over her belly as the tight lace fabric once again covered her nakedness. For a few long moments Lorenzo didn't move, leaning his whole weight against the window's edge, concerned he might collapse. Ava swiftly pulled him towards her, kissing his earlobe, as the head of his hot dripping cock pressed gently into the slick dampness within her black panties.

Across the top floor of the college library, one of their classmates entered. He glanced around, looking for a suitable table, noticing a couple on the far side standing by a window. They were seemingly in a close embrace, waists masked by a nearby table, conveniently blocked by the library books Lorenzo had piled there. It was alright for them, watching the sports games out on the field. He had work to catch up on.

Minutes later the two young people had gone, their mutual education and extensive studies apparently over for the afternoon.

Parts 2 to 10 to follow

  1. Ava wondered if Lorenzo still held the same desires for the submissive role he once relished in their BDSM sessions, considering their past experiences and the event that had separated them.
  2. The library atmosphere was a familiar one to Ava, particularly the sensation of his fingers tracing gently over her arm, a signal they'd used to indicated their switch to BDSM roles during their university days.
  3. The act of fingering the books in the library brought back memories of him whispering commands in her ear during their anal play sessions, a role that had further cemented their bondage and domination relationship.
  4. In that moment, as she sat at the library table watching him, Ava yearned for the feeling of the whip against her skin, a sensation she'd only truly experienced in the thrilling realm of their BDSM activities.
  5. As she closed her eyes and imagined the sensation of being suspended from the ceiling in the BDSM toy shop, Ava felt a pang of excitement, longing for the days when they indulged in their mutual desire of taking control, submission, and bondage under the guise of 'Taking Control Part 1,' a tagline that had become synonymous with their intense, sexual journey.

Read also: